Carubv10018622m (PRGDB220284)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB220284	Carubv10018622m	CT	putative	CC, TIR	Capsella rubella

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.28243s0034.1.p	Babiana stricta	71.2	163	8e-76
Cagra.6207s0004.1.p	Conradina grandiflora	91.7	121	2e-75
Carubv10018802m	Capsella rubella	69.3	163	2e-75
Bostr.28243s0030.1.p	Babiana stricta	69.9	163	6e-74
Bostr.0556s0150.1.p	Babiana stricta	68.1	166	3e-72
Bostr.0556s0145.1.p	Babiana stricta	70.9	158	2e-71
Carubv10018868m	Capsella rubella	68.1	163	4e-71
Cagra.2161s0001.1.p	Conradina grandiflora	68.7	163	1e-70
Araha.49972s0001.1.p	Arabidopsis halleri	61	177	3e-67
Bostr.11774s0003.1.p	Babiana stricta	58.5	193	2e-66

Showing 1 to 10 of 499 entries

Protein sequence

FLNFRGEQLRDNFVSHLTYALTRDGINFFIDEKEQRGQDLENLFVRIEESSIALAIFSSRYPESKWCMDE
LVVMQKFAKQGNLRVIPIFYKVEPEDVRHPTLDSEFGKNFLSLAEASTQDQVKEWKEALKFICGKMGSSL
REKSSESDFVNEIAKNVKELEESQLQTRKNQWRSWAVNSDASN