AHYPO_011357-RA (PRGDB22691)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB22691	AHYPO_011357-RA	T	putative	TM, TIR	Amaranthus hypochondriacus

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AHYPO_004168-RA	Amaranthus hypochondriacus	58.4	166	3e-60
Ciclev10018304m	Citrus clementina	51.7	149	1e-41
orange1.1g046164m	Citrus sinensis	51.7	149	2e-41
Manes.16G024000.1.p	Manihot esculenta	55.8	138	2e-41
DCAR_004121	Daucus carota	50	168	1e-40
Manes.17G042000.1.p	Manihot esculenta	51.7	149	1e-39
Prupe.4G041100.1.p	Prunus persica	48.7	152	3e-39
VIT_19s0014g03230.t01	Vitis vinifera	51.5	138	4e-39
Gorai.009G170500.1	Gossypium raimondii	46.4	166	4e-39
Gorai.011G025200.1	Gossypium raimondii	44	168	2e-38

Showing 1 to 10 of 217 entries

Protein sequence

MQHSIFSKCFASSSRILRPTTRPSQTTLKQTCDVFINHRGNDTKRTIAGLLYQHLSRLGYYPFLDSKSMK
PGDNLYKKIDPECKKKVLPIFWDVKPSELRVLDNGSCTNTKELQRFQRAIDEAKNIVGLTFNTSNGLVLI
YFYICYL