Eucgr.G01282.1.p (PRGDB228563)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228563	Eucgr.G01282.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.G01286.1.p	Eucalyptus grandis	60.8	74	3e-25
Eucgr.G00433.1.p	Eucalyptus grandis	59.5	74	5e-24
Eucgr.G01283.1.p	Eucalyptus grandis	72.5	51	2e-21
Eucgr.G00432.1.p	Eucalyptus grandis	60	50	8e-15
Eucgr.G01276.1.p	Eucalyptus grandis	42.1	76	9e-11
Eucgr.G01255.1.p	Eucalyptus grandis	48	50	2e-8
Eucgr.G01250.1.p	Eucalyptus grandis	48	50	3e-8
Gorai.007G322300.1	Gossypium raimondii	41.2	68	1e-7
Eucgr.E02189.1.p	Eucalyptus grandis	33.8	74	2e-7
Eucgr.H02207.1.p	Eucalyptus grandis	34.7	72	4e-7

Showing 1 to 10 of 10 entries

Protein sequence

MNARKLREQRRHFVKNIGQGEKGFEQDNPHQVQRWRNALRTLGMIKGWTVNISLHKTEAEVIEELADKIS
AKLDHLE