Eucgr.G01286.1.p (PRGDB228635)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228635	Eucgr.G01286.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.G00433.1.p	Eucalyptus grandis	95.5	154	7e-105
Eucgr.G00431.1.p	Eucalyptus grandis	83	100	9e-56
Eucgr.G01283.1.p	Eucalyptus grandis	65.5	119	1e-50
Eucgr.G00432.1.p	Eucalyptus grandis	65.5	119	2e-45
Eucgr.G01276.1.p	Eucalyptus grandis	48.2	141	8e-36
Eucgr.G01255.1.p	Eucalyptus grandis	50.4	117	1e-34
Eucgr.H02074.1.p	Eucalyptus grandis	38.5	143	3e-30
Medtr5g037710.1	Medicago truncatula	41.4	140	4e-30
Eucgr.G01250.1.p	Eucalyptus grandis	50	114	6e-30
Eucgr.G01279.1.p	Eucalyptus grandis	57.6	92	1e-29

Showing 1 to 10 of 499 entries

Protein sequence

MRTVVDYTLDRGEEIWPAIEEAIKQSNIAVVVVSQNYHCSPWCLDELEKILECRKKGGLIVLPIFWGIDA
RELREPSSSFVENIGQGEEGFKQKNPHLAQRWKKALQAVGRIIGFTVNASLDRTEAEVIEALADEIAAEL
NRSASIFTSHPACG