Eucgr.G00433.1.p (PRGDB228634)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228634	Eucgr.G00433.1.p	T	putative	TM, TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.G01286.1.p	Eucalyptus grandis	95.5	154	7e-105
Eucgr.G00431.1.p	Eucalyptus grandis	81	100	1e-53
Eucgr.G01283.1.p	Eucalyptus grandis	64.7	119	1e-48
Eucgr.G00432.1.p	Eucalyptus grandis	63.9	119	7e-44
Eucgr.G01276.1.p	Eucalyptus grandis	47.5	141	2e-34
Eucgr.G01255.1.p	Eucalyptus grandis	50.4	117	4e-34
Medtr5g037710.1	Medicago truncatula	42.9	140	5e-32
Glyma.02G023800.1.p	Glycine max	42.1	140	2e-31
Medtr5g037610.1	Medicago truncatula	41.4	140	8e-31
Eucgr.H02074.1.p	Eucalyptus grandis	37.8	143	9e-30

Showing 1 to 10 of 499 entries

Protein sequence

MRTVVDYTLDRGEEIWPAIEEAIKQSNIAVVVVSQNYHCSPWCLDELEKILECRKMGGLIVLPIFWGIDA
GELREPSSSFVENIGQGEEGFKQQNPHLAQRWRKALQAVGRIIGFTVNASLDRAEAEVIEALADEIAAEL
NRSVSNFTSHPACG