Eucgr.C02141.5.p (PRGDB228579)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228579	Eucgr.C02141.5.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.C02141.4.p	Eucalyptus grandis	80.4	194	7e-105
Eucgr.C02141.3.p	Eucalyptus grandis	80.4	194	7e-105
Eucgr.C02141.1.p	Eucalyptus grandis	76.2	164	7e-80
Eucgr.C02141.2.p	Eucalyptus grandis	76.7	163	3e-79
Eucgr.C02142.1.p	Eucalyptus grandis	54.1	109	4e-27
Eucgr.B01956.1.p	Eucalyptus grandis	37.2	113	1e-17
Eucgr.H03501.1.p	Eucalyptus grandis	41.7	108	5e-16
Eucgr.C00409.1.p	Eucalyptus grandis	44.3	88	3e-15
Eucgr.C01356.1.p	Eucalyptus grandis	36.6	101	4e-15
Eucgr.L03036.1.p	Eucalyptus grandis	43.3	97	2e-14

Showing 1 to 10 of 214 entries

Protein sequence

MMNADSTSSGEGRSCRGSTEHDEAEHLPMSSQFSSQPQVAGSEVSIPILSESYAASKRRLCELVQMTKNR
KSAGHVVIPFFHRVEFDRAFCSHEMCFEQREVEAGQQGLRDLSILKGWESEKIANGYVISSPFTLVVFLS
MRSFCCNPRFLIGRIEI