Eucgr.J00117.1.p (PRGDB228590)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228590	Eucgr.J00117.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.H02176.1.p	Eucalyptus grandis	47.8	157	3e-43
Eucgr.H02184.1.p	Eucalyptus grandis	47.1	157	4e-42
Eucgr.H02155.1.p	Eucalyptus grandis	49.3	144	4e-42
Eucgr.H02148.1.p	Eucalyptus grandis	48.3	145	2e-41
Eucgr.H01749.1.p	Eucalyptus grandis	46.7	152	4e-39
Eucgr.H01903.1.p	Eucalyptus grandis	45.2	157	1e-38
Eucgr.H02116.1.p	Eucalyptus grandis	46.3	162	1e-38
Eucgr.H02074.1.p	Eucalyptus grandis	48.3	147	2e-38
Eucgr.C03460.1.p	Eucalyptus grandis	45.9	157	3e-38
Eucgr.H02032.1.p	Eucalyptus grandis	44.6	157	4e-38

Showing 1 to 10 of 499 entries

Protein sequence

MATSEEEQQQFKYDVFLSYNRRERDAGSFFPQHLHDVLTQKGIKSYKYGEDLEEGEETAPAVDEAIKGSR
IALVILSRRYASSASCLSELGTILEQNNQIGKRVMPLFYGVEPSWVRRQRESYQEAMAEHESRYGSGSDK
VRQWREALTEVGDLRGWILAGNQYV