Eucgr.G00431.1.p (PRGDB228633)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228633	Eucgr.G00431.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.G01286.1.p	Eucalyptus grandis	83	100	6e-56
Eucgr.G00433.1.p	Eucalyptus grandis	81	100	8e-54
Eucgr.G01283.1.p	Eucalyptus grandis	71	100	5e-46
Eucgr.G00432.1.p	Eucalyptus grandis	62.8	94	2e-32
Eucgr.G01279.1.p	Eucalyptus grandis	58.7	92	1e-31
Eucgr.G01255.1.p	Eucalyptus grandis	49	100	3e-26
Eucgr.G01276.1.p	Eucalyptus grandis	50	100	1e-25
Eucgr.G01250.1.p	Eucalyptus grandis	49.5	99	8e-25
Glyma.18G128000.1.p	Glycine max	39	100	2e-22
Medtr5g037710.1	Medicago truncatula	48	98	3e-22

Showing 1 to 10 of 499 entries

Protein sequence

MKTVIDYILDGGKEIWPAIEEAIEQSNIAVVVVSQNYHFSPWCLNELVKILECRKKGGLILLPIFWGIEA
RELRKPSSPFVENIGQGEEGFKQENLHQVQ