Glyma.15G070500.1.p (PRGDB236292)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB236292	Glyma.15G070500.1.p	T	putative	TIR	Glycine max

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Glyma.07G193000.1.p	Glycine max	64	175	3e-77
Glyma.15G070400.1.p	Glycine max	61	172	8e-72
Glyma.13G243000.1.p	Glycine max	62	171	2e-71
Manes.16G024000.1.p	Manihot esculenta	60.7	163	2e-69
Phvul.006G188800.1	Phaseolus vulgaris	58.7	172	8e-69
Potri.011G046800.1	Populus trichocarpa	57	172	4e-68
Manes.17G042000.1.p	Manihot esculenta	60	160	6e-67
Potri.004G038200.1	Populus trichocarpa	56.5	170	2e-65
orange1.1g046164m	Citrus sinensis	58.9	163	2e-65
Thecc1EG029929t1	Theobroma cacao	54.8	177	7e-65

Showing 1 to 10 of 499 entries

Protein sequence

MSQFIRAKQCRNIVQPVYDVFINYRKVDNGRTFVPLLYDHLRIKGIKPFLDTMNMKPGHKLFEHINKAIH
SSKVGVAVLTHRYCDSYFCLHELTLLNESKKRVVPIFYDIKPSQLQLKGNARYPPQELQRFMSALEETKY
TVGVSFDSLNGDWMELQRKISDAVIMNLIEIEDEETRNMQP