MDP0000610616 (PRGDB258281)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258281	MDP0000610616	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000661138	Malus domestica	72.5	153	3e-71
MDP0000946278	Malus domestica	69.8	159	2e-70
MDP0000601632	Malus domestica	69.8	159	2e-70
MDP0000314565	Malus domestica	71.2	146	4e-63
MDP0000173893	Malus domestica	72.6	146	1e-58
MDP0000605598	Malus domestica	68.8	138	2e-58
MDP0000216668	Malus domestica	60.8	153	7e-53
MDP0000294696	Malus domestica	70.6	119	9e-52
Prupe.4G260800.1.p	Prunus persica	63.4	131	4e-50
MDP0000487979	Malus domestica	77.7	103	6e-50

Showing 1 to 10 of 499 entries

Protein sequence

MALVRTSPRTSSDPNTFRGHRYDVFLSFRGKGTRKTFRVRLLHRTISDWTSDHLYTDLNNAGFLTIRDDN
ELERREDIKPGLQKAIQLSRTSVVVFSKYYATSRWCLNELVLILELKRTTSNHVVLPIFYDVDPSHLRKQ
TGILEKHLLDTRKLSRRKR