MDP0000128200 (PRGDB258292)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258292	MDP0000128200	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000651853	Malus domestica	99.1	108	4e-72
MDP0000140578	Malus domestica	85.2	108	5e-58
MDP0000289761	Malus domestica	73.8	107	2e-50
MDP0000317951	Malus domestica	74.1	108	8e-49
MDP0000695029	Malus domestica	74.1	108	8e-49
MDP0000479325	Malus domestica	74.1	108	1e-48
MDP0000706467	Malus domestica	74.1	108	4e-48
MDP0000637728	Malus domestica	62	108	1e-41
MDP0000249335	Malus domestica	61.5	104	3e-40
MDP0000827937	Malus domestica	51.3	113	3e-34

Showing 1 to 10 of 499 entries

Protein sequence

GEPITPALKQAIKDSRLAAIIFSRGYAESRWCLEELVEILARKERKGLMVLPIFYDIDPTDVRHQTGDFE
EAFQRHQERFPDKVQIWKDAVNAAAELAGEAYSEAAGYYLLPFPF