MDP0000150743 (PRGDB258311)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258311	MDP0000150743	T	putative	TM, TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000216668	Malus domestica	90.4	115	3e-63
MDP0000946278	Malus domestica	74.1	116	2e-55
MDP0000601632	Malus domestica	74.1	116	2e-55
MDP0000661138	Malus domestica	74.1	116	3e-53
MDP0000314565	Malus domestica	68.1	116	7e-48
MDP0000173893	Malus domestica	72.4	116	2e-47
MDP0000610616	Malus domestica	60.9	128	7e-46
Prupe.2G126100.1.p	Prunus persica	73	115	4e-45
MDP0000605598	Malus domestica	69.2	107	4e-45
Prupe.2G126900.1.p	Prunus persica	69.6	115	6e-45

Showing 1 to 10 of 499 entries

Protein sequence

MDLVRTTQVTSSYSNSRRGYHYDVFLSFRGEDTRKTFTDHLYTALKSAGYRTFRDDDELETREGIKWGLK
QAIQMSRTSVIVFSKDYASSRWCLNELVEIVDHKRTSSDHVVIPVLLVFDFLIDSMEQ