MDP0000422549 (PRGDB258380)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258380	MDP0000422549	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000222184	Malus domestica	92.2	77	3e-44
MDP0000190736	Malus domestica	89.3	75	8e-42
MDP0000214291	Malus domestica	85.7	77	3e-41
MDP0000309329	Malus domestica	85.7	77	6e-41
MDP0000222371	Malus domestica	85.7	77	3e-40
MDP0000194082	Malus domestica	83.1	77	3e-40
MDP0000177288	Malus domestica	77.9	77	1e-35
MDP0000190522	Malus domestica	84.4	64	2e-32
MDP0000258012	Malus domestica	73.3	75	2e-30
MDP0000192278	Malus domestica	83.9	62	3e-30

Showing 1 to 10 of 499 entries

Protein sequence

MDDEALKRGAEISLALLKEIEDSRISLVVFSENYASSEWCLDELVHIFHCKKQLQQMVFPVFYKVDPSDV
RNQTKEFXGTC