mrna32631.1-v1.0-hybrid (PRGDB234692)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB234692	mrna32631.1-v1.0-hybrid	T	putative	TIR	Fragaria vesca

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.5G074700.2.p	Prunus persica	77.2	158	1e-77
Prupe.5G074700.1.p	Prunus persica	77.2	158	1e-77
Prupe.5G074700.3.p	Prunus persica	77.2	158	1e-77
Prupe.5G074700.4.p	Prunus persica	77.2	158	1e-77
Prupe.5G074600.1.p	Prunus persica	76.1	155	4e-77
Prupe.8G110600.1.p	Prunus persica	63.5	167	1e-67
Prupe.2G088600.1.p	Prunus persica	66	150	1e-67
Prupe.8G108700.1.p	Prunus persica	63.8	149	8e-67
Prupe.1G161400.1.p	Prunus persica	62.4	149	9e-66
MDP0000309329	Malus domestica	59.9	172	1e-65

Showing 1 to 10 of 499 entries

Protein sequence

MACNMNRGVTASSSSSFTPIRWSYDVFLSFRGEDTRNNFTGHLYTALCQRGLHTFIDDHDLRKGEEIGPT
LVKAVQESRVSVIVFSENYASSKWCLDELLIILDCKESKGQLVWPIFYKVNPSDVRNQRGSFAVAMREHE
VQFNFDMDRVQSWRTALTHAASLSGWHFPDG