Araha.37770s0001.1.p (PRGDB28320)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB28320	Araha.37770s0001.1.p	T	putative	TM, TIR	Arabidopsis halleri

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
893751	Arabidopsis lyrata	98.3	176	1e-123
Carubv10019041m	Capsella rubella	73.1	175	3e-91
864783	Arabidopsis lyrata	70.3	175	4e-87
Araha.13567s0001.1.p	Arabidopsis halleri	69.7	175	8e-87
AT2G03300.1	Arabidopsis thaliana	69.1	175	7e-85
Araha.49972s0001.1.p	Arabidopsis halleri	73.8	164	1e-84
Carubv10019542m	Capsella rubella	69.2	172	2e-83
Carubv10018648m	Capsella rubella	71.3	171	3e-83
Carubv10019003m	Capsella rubella	70	170	9e-83
Thhalv10005569m	Eutrema salsugineum	68	172	2e-82

Showing 1 to 10 of 499 entries

Protein sequence

MSSLVFFNYRGAELRYSFVSHLSDAFERHGINFFLDNHEQRGKDLANLFVRIEESRIALAIFSTRYAESS
WCMDELVKMKKCVDKGKLQVIPIFYKIRARDVRGQTGKFGDKFWELAKVSRGDKIKKWKDALECITGKMG
LSLGEKCSEAGFIMEIIKEVKIVLAAIGREGKEHNY