893751 (PRGDB29743)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29743	893751	T	putative	TM, TIR	Arabidopsis lyrata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.37770s0001.1.p	Arabidopsis halleri	98.3	176	2e-123
Carubv10019041m	Capsella rubella	66.8	199	6e-90
864783	Arabidopsis lyrata	64.5	203	2e-86
Araha.13567s0001.1.p	Arabidopsis halleri	64	203	6e-86
Carubv10019003m	Capsella rubella	65.8	187	5e-84
Carubv10019542m	Capsella rubella	64.2	201	1e-83
AT2G03300.1	Arabidopsis thaliana	63.2	204	3e-83
Thhalv10005569m	Eutrema salsugineum	65.6	183	1e-82
Araha.49972s0001.1.p	Arabidopsis halleri	73.2	164	3e-82
Carubv10018648m	Capsella rubella	69.2	182	8e-82

Showing 1 to 10 of 499 entries

Protein sequence

MSSLVFFNYRGAELRYSFVSHLSDAFERHGINFFLDNHELRGKDLANLFVRIEESRIALAIFSTRYAESS
WCMDELVKMKKCVDKGKLKVIPIFYKIRARDVRGQTGKFGDKFWELAKVSRGDKIKKWKDALECITGKMG
LSLGKKCSEAGFIMEIIKEVKIVLAAIGREGKEHNYVSVLKNKKRKIWNCPYEPVHYKRSNIQKF