ORUFI03G36180.1 (PRGDB295956)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB295956	ORUFI03G36180.1	L	putative	LRR	Oryza rufipogon

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
BGIOSGA013589-PA	Oryza sativa Indica Group	97.1	68	8e-39
LOC_Os03g55014.1	Oryza sativa	97.1	68	9e-38
ONIVA03G36230.1	Oryza nivara	96.4	55	4e-22
ORGLA03G0317600.1	Oryza glaberrima	92.7	55	3e-18
OB05G15000.1	Oryza brachyantha	57.7	52	7e-13
Araha.11097s0008.1.p	Arabidopsis halleri	59.3	54	8e-13
Kalax.0396s0049.1.p	Kalanchoe marnieriana	59.3	54	9e-13
30189.m001657	Ricinus communis	60.4	53	1e-12
Kalax.0940s0019.1.p	Kalanchoe marnieriana	59.3	54	1e-12
Manes.18G143800.1.p	Manihot esculenta	58.5	53	1e-12

Showing 1 to 10 of 445 entries

Protein sequence

MAPSLSSSHSPLPMMMASAPSSPRADAVGLPDDLNHSDIAGYMPSELGLLADLALLYLNSNRFCASSR