ORGLA03G0317600.1 (PRGDB278848)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB278848	ORGLA03G0317600.1	L	putative	LRR	Oryza glaberrima

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
ONIVA03G36230.1	Oryza nivara	92.7	55	2e-20
ORUFI03G36180.1	Oryza rufipogon	92.7	55	5e-18
BGIOSGA013589-PA	Oryza sativa Indica Group	89.1	55	2e-16
LOC_Os03g55014.1	Oryza sativa	89.1	55	4e-16
OB05G15000.1	Oryza brachyantha	57.7	52	1e-12
Bo9g037330.1	Brassica oleracea	60	50	5e-12
30189.m001657	Ricinus communis	57.7	52	6e-12
evm_27.model.AmTr_v1.0_scaffold00025.338	Amborella trichopoda	75.8	33	1e-11
Aco009810.1	Ananas comosus	58.5	53	2e-11
Gorai.012G009700.1	Gossypium raimondii	59.2	49	2e-11

Showing 1 to 10 of 358 entries

Protein sequence

MAPSLSSSHSPLPMMMASAPTSPRADAVGSPDDLNHSDIAGYMPPELGLLADLALLYLNSNCFCASSR