LOC_Os03g55014.1 (PRGDB298676)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB298676	LOC_Os03g55014.1	L	putative	LRR	Oryza sativa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
BGIOSGA013589-PA	Oryza sativa Indica Group	99.9	68	2e-40
ORUFI03G36180.1	Oryza rufipogon	97.1	68	9e-38
ONIVA03G36230.1	Oryza nivara	92.7	55	1e-19
ORGLA03G0317600.1	Oryza glaberrima	89.1	55	3e-16
30189.m001657	Ricinus communis	60.8	51	1e-11
Araha.11097s0008.1.p	Arabidopsis halleri	60.8	51	2e-11
Kalax.0396s0049.1.p	Kalanchoe marnieriana	60.8	51	2e-11
Manes.18G143800.1.p	Manihot esculenta	58.8	51	2e-11
OB05G15000.1	Oryza brachyantha	58	50	2e-11
AT1G62440.1	Arabidopsis thaliana	60.8	51	2e-11

Showing 1 to 10 of 383 entries

Protein sequence

MAPSLSSSHSPLPMMMASAPSSPRANAVGLPDDLNHSDIAGYMPSELGLLADLALLYLNSNRFRASSR