AT1G61105.1 (PRGDB211208)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB211208	AT1G61105.1	T	putative	TM, TIR	Arabidopsis thaliana

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.19457s0002.1.p	Arabidopsis halleri	93	185	2e-127
Bostr.10040s0090.1.p	Babiana stricta	84.3	185	9e-111
315245	Arabidopsis lyrata	95.1	162	5e-109
Bo9g043330.1	Brassica oleracea	83.2	184	6e-108
Thhalv10023985m	Eutrema salsugineum	81.5	162	2e-90
Thecc1EG029929t1	Theobroma cacao	64.8	182	1e-78
Glyma.15G070400.1.p	Glycine max	65.4	185	6e-78
Prupe.4G041100.1.p	Prunus persica	70.5	156	2e-77
Glyma.13G243000.1.p	Glycine max	65.2	184	3e-77
MDP0000178596	Malus domestica	68.5	159	8e-77

Showing 1 to 10 of 499 entries

Protein sequence

MQRLLTPCSKIAYTTRYIANPTLPYPNPCDIFINHRGIDTKKTISGLLYDCFTRQRLTAFLDSKSLKPGD
RLFVEIDMAIKACGVGIAVFSPRYCDSYFCLHELALLVKNKKRVIPIFCDVKPSELCVKDDKTRPAAEIR
RFQLALEEAKYTVGLTFDTSNGDWSEFLAMASDAVTKNLLEVEERIGD