Bo9g043330.1 (PRGDB219880)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB219880	Bo9g043330.1	T	putative	TIR	Brassica oleracea

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.10040s0090.1.p	Babiana stricta	80.6	196	3e-114
Araha.19457s0002.1.p	Arabidopsis halleri	79.4	199	5e-110
AT1G61105.1	Arabidopsis thaliana	83.2	184	6e-108
315245	Arabidopsis lyrata	84.6	162	3e-91
Thhalv10023985m	Eutrema salsugineum	81.4	161	3e-90
Thecc1EG029929t1	Theobroma cacao	65.4	185	2e-81
Manes.17G042000.1.p	Manihot esculenta	69.7	165	8e-81
MDP0000178596	Malus domestica	67.1	167	8e-81
Prupe.4G041100.1.p	Prunus persica	67.1	170	3e-80
Glyma.13G243000.1.p	Glycine max	70.4	159	2e-79

Showing 1 to 10 of 499 entries

Protein sequence

MQRLSVPCSKLACTKYLANPTLRNQNPCDIFINHRGIDTKKTISGLLYDRFTRLGLNSFLDSKNLKPGDK
LFVEIKAAIKECSAGIAVFSPRYCDSYFCLHELTMLMESKKRVIPIFCDVKPSELCVKDDRTRPAAEIRR
FRLALEEAKYTVGLTFDTSNGDWSEFLAKASDAVTKNLLDVEEARLRSINPTYKHIPA