Thhalv10023985m (PRGDB233134)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB233134	Thhalv10023985m	T	putative	TIR	Eutrema salsugineum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.19457s0002.1.p	Arabidopsis halleri	83.3	162	8e-94
315245	Arabidopsis lyrata	84	163	3e-92
Bostr.10040s0090.1.p	Babiana stricta	82	161	7e-92
AT1G61105.1	Arabidopsis thaliana	81.5	162	2e-90
Bo9g043330.1	Brassica oleracea	81.4	161	3e-90
Manes.17G042000.1.p	Manihot esculenta	71.3	143	1e-70
Prupe.4G041100.1.p	Prunus persica	70.3	138	5e-70
Ciclev10018304m	Citrus clementina	65.2	155	1e-69
orange1.1g046164m	Citrus sinensis	65.2	155	1e-69
SapurV1A.0044s0430.1.p	Salix purpurea	65.8	149	4e-69

Showing 1 to 10 of 499 entries

Protein sequence

MPRLLAPCSKLAYTRYIRKPTIPNPNRCDIFINHRGIDTKKTISGLLYDHFNRLRLNSFLDSKSLKPGDR
LFVEINAAIKECSVGVAVFSPRYCDSYFCLHELTKLMENKKRVIPIFCDIKPSELCVKDDGTCSDAEIER
FQSALEEAKYTVGLTFDTSNGYALSQSYSLFYNVHQNLTLCGL