Bostr.10040s0090.1.p (PRGDB212920)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB212920	Bostr.10040s0090.1.p	T	putative	TIR	Babiana stricta

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bo9g043330.1	Brassica oleracea	80.6	196	3e-114
Araha.19457s0002.1.p	Arabidopsis halleri	84.5	187	1e-112
AT1G61105.1	Arabidopsis thaliana	84.3	185	1e-110
315245	Arabidopsis lyrata	87.7	162	2e-94
Thhalv10023985m	Eutrema salsugineum	82	161	8e-92
Thecc1EG029929t1	Theobroma cacao	63.5	181	1e-80
orange1.1g046164m	Citrus sinensis	65.3	170	3e-80
Ciclev10018304m	Citrus clementina	64.7	170	6e-80
Potri.004G038200.1	Populus trichocarpa	68.5	162	8e-80
Potri.011G046800.1	Populus trichocarpa	71.2	156	1e-79

Showing 1 to 10 of 499 entries

Protein sequence

MQRLLAPSSKLASTRWITNPTPLYPNPCDIFINHRGIDTKKTVSGLLYDHLTRLRLNAFLDSKSLKPGDK
LFVEINTAIKACEVGIAVFSPRYCDSYFCLHELTLLMENKKRVIPIFCDVKPSELFVKDDGTRPAAEIRR
FQLALKEARYTVGLTFDTSNGDWSKFLGMASDAVTNHLLEVEERRIRSINPTYKHIIT