AT1G52900.1 (PRGDB211212)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB211212	AT1G52900.1	T	putative	TIR	Arabidopsis thaliana

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Cagra.0946s0026.1.p	Conradina grandiflora	90.9	198	2e-131
Araha.27238s0001.1.p	Arabidopsis halleri	96.4	194	3e-128
882954	Arabidopsis lyrata	96.4	194	5e-128
Bostr.0124s0083.1.p	Babiana stricta	89.5	200	5e-122
Thhalv10012278m	Eutrema salsugineum	87.9	198	1e-119
Manes.03G113800.1.p	Manihot esculenta	68.1	160	5e-77
Potri.001G403800.1	Populus trichocarpa	68.8	170	1e-76
Potri.011G123100.1	Populus trichocarpa	69.2	159	2e-75
Thecc1EG031369t1	Theobroma cacao	64.8	176	8e-75
Manes.15G084900.1.p	Manihot esculenta	60.4	187	8e-75

Showing 1 to 10 of 499 entries

Protein sequence

MISRVFNFMKQSETVQLNNKLFLDLLSSSSSAKPKILHDVFINHRGSDTKRNIATLLYDNLKSRNLRPFL
DSKNMKPGDKLFDHINNAILTSKVAVTVFSPNYCDSYFCLHELALIMESRKRVIPIFCDIKPSQLDVMIE
RVTCSDDEIQRFRWALQEAKDIVGLTFDSYKGNLSEVVTVASDVIVERLVELEAKDENL