882954 (PRGDB29734)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29734	882954	T	putative	TM, TIR	Arabidopsis lyrata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.27238s0001.1.p	Arabidopsis halleri	99	195	2e-140
Cagra.0946s0026.1.p	Conradina grandiflora	92.3	194	2e-130
AT1G52900.1	Arabidopsis thaliana	96.4	194	8e-128
Bostr.0124s0083.1.p	Babiana stricta	91.8	195	1e-121
Thhalv10012278m	Eutrema salsugineum	89.6	193	2e-117
Potri.001G403800.1	Populus trichocarpa	70.7	167	8e-76
Manes.03G113800.1.p	Manihot esculenta	69.7	155	3e-75
Potri.011G123100.1	Populus trichocarpa	71.2	156	1e-74
Manes.15G084900.1.p	Manihot esculenta	69	155	5e-74
Thecc1EG031369t1	Theobroma cacao	64.8	176	1e-73

Showing 1 to 10 of 499 entries

Protein sequence

MISRVFNFMKQSKTAQLNNKLFLDLLSSSSSAKPKVLHDVFINHRGSDTKRNIATLLYDNLKYRNLRPFL
DCKNMKPGDKLFDHINSAILTSKVAVTVFSPNYCDSYFCLHELALIMESRKRVIPIFCDIKPSQLDVMIE
RVTCSDDEIQRFRWALQEAKDIVGLTFDSYKGNLSEVVTIASDVIVERLVELEAS