Bostr.0124s0083.1.p (PRGDB212919)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB212919	Bostr.0124s0083.1.p	T	putative	TIR	Babiana stricta

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Cagra.0946s0026.1.p	Conradina grandiflora	92	199	3e-132
AT1G52900.1	Arabidopsis thaliana	91	200	4e-122
Araha.27238s0001.1.p	Arabidopsis halleri	93.3	195	5e-122
882954	Arabidopsis lyrata	93.3	195	7e-122
Thhalv10012278m	Eutrema salsugineum	85.9	199	5e-115
Potri.001G403800.1	Populus trichocarpa	72	157	2e-75
Manes.03G113800.1.p	Manihot esculenta	66.5	161	2e-75
Potri.011G123100.1	Populus trichocarpa	70.1	157	1e-74
VIT_19s0014g03230.t01	Vitis vinifera	68.8	157	7e-74
Manes.15G084900.1.p	Manihot esculenta	66.2	157	4e-72

Showing 1 to 10 of 499 entries

Protein sequence

MISRVFNFMKQSKTVQLNNKLFLDLLSSSSSAPKPKALFDVFINHRGADTKRNIATLLYDNLTSRNLRPF
LDCKTMKPGDKLYDHINSAILTSKVAVTVFSPNYCESFFCLHELALIMESRKRVIPIFCDIKPSQLDVMI
ERLACSDDEIQRFRWALQEAKDIVGLTFDSYKGNLSEVVTIASDVIVERLVELEAEDGNV