Thhalv10012278m (PRGDB233132)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB233132	Thhalv10012278m	T	putative	TIR	Eutrema salsugineum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Cagra.0946s0026.1.p	Conradina grandiflora	85.4	199	2e-120
AT1G52900.1	Arabidopsis thaliana	87.9	198	1e-116
882954	Arabidopsis lyrata	89.6	193	1e-114
Araha.27238s0001.1.p	Arabidopsis halleri	89.1	193	3e-114
Bostr.0124s0083.1.p	Babiana stricta	83.5	200	3e-111
Potri.001G403800.1	Populus trichocarpa	62.6	190	1e-71
Manes.03G113800.1.p	Manihot esculenta	65.2	161	2e-71
Potri.011G123100.1	Populus trichocarpa	64.2	173	7e-71
Thecc1EG031369t1	Theobroma cacao	60.6	180	2e-69
Gorai.002G073500.1	Gossypium raimondii	59.4	175	2e-68

Showing 1 to 10 of 499 entries

Protein sequence

MISRVFDFMKQSKSIQLNNKPFLDLLSSSSSTKPKALHDVFINHRGSDTKRNIATLLYDNLKARNLRPFL
DIKSMKPGDKLFDHINQGILTSKVAVTVFSPNYCNSYCCLHELALIMESKKRVIPIFFDVKPSQLDVMIE
RVRCPDDEIQRFRWALQEAKDIVGLTFDSCKGNLSEVVMIASDVIVERLVELEDEDENA