AT1G57850.2 (PRGDB211215)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB211215	AT1G57850.2	T	putative	TIR	Arabidopsis thaliana

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AT1G57850.1	Arabidopsis thaliana	99.9	114	1e-78
893736	Arabidopsis lyrata	87.1	124	2e-71
Bostr.30057s0052.1.p	Babiana stricta	91.9	111	5e-68
Araha.37770s0001.1.p	Arabidopsis halleri	76.6	111	2e-57
893751	Arabidopsis lyrata	76.6	111	5e-57
Carubv10019041m	Capsella rubella	73.1	119	3e-56
864783	Arabidopsis lyrata	74	119	6e-56
Araha.13567s0001.1.p	Arabidopsis halleri	75.7	111	2e-55
AT2G03300.1	Arabidopsis thaliana	75.7	111	3e-55
Thhalv10005569m	Eutrema salsugineum	74.6	114	5e-55

Showing 1 to 10 of 499 entries

Protein sequence

MEQGKKSERSMKKKQRRRWKKREKTREDVNKDKDELRGKTMTNLFVRIKESKIALVIFSSRYAESSWCMD
ELVKMKKRADKGKLQVIPIFYKVRARDVRGQTGEFGETFWALARTSRGDQIMEWKEALECISNKMGLSLG
DKRYS