893736 (PRGDB29740)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29740	893736	T	putative	TIR	Arabidopsis lyrata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AT1G57850.1	Arabidopsis thaliana	91.8	158	2e-99
Bostr.30057s0052.1.p	Babiana stricta	91.8	134	4e-82
Araha.37770s0001.1.p	Arabidopsis halleri	75.5	143	5e-73
893751	Arabidopsis lyrata	75.5	143	5e-72
AT1G57850.2	Arabidopsis thaliana	91.4	116	2e-71
Carubv10019041m	Capsella rubella	71	155	3e-70
864783	Arabidopsis lyrata	70.3	155	2e-69
Araha.13567s0001.1.p	Arabidopsis halleri	70.3	155	2e-69
Carubv10019542m	Capsella rubella	68.4	155	6e-68
AT2G03300.1	Arabidopsis thaliana	69.7	155	7e-68

Showing 1 to 10 of 499 entries

Protein sequence

MTISSLTDDTHRVFLSFRGDQLRYSFVSHLLDAFKRHGILCFVHKDEHLRGKNMTNLFVRIKESKIALVI
FSSRYAESSWCMDELVKMKKRVDKGKLQVIPIFYKVRARDVRGQTGEFGDKFWALAKTSRVDQIMEWKEA
LECISNKMGLSLGDKRY