Cagra.6207s0004.1.p (PRGDB225297)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB225297	Cagra.6207s0004.1.p	T	putative	TIR	Conradina grandiflora

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Carubv10018622m	Capsella rubella	91.7	121	1e-75
Bostr.28243s0030.1.p	Babiana stricta	68.4	152	5e-66
Cagra.2161s0001.1.p	Conradina grandiflora	74.1	135	6e-66
Bostr.0556s0150.1.p	Babiana stricta	72.5	131	2e-64
Bostr.28243s0034.1.p	Babiana stricta	73.8	130	8e-64
Bostr.11774s0003.1.p	Babiana stricta	68.2	148	2e-63
Bostr.28243s0032.1.p	Babiana stricta	66.4	149	5e-62
Bostr.0556s0151.1.p	Babiana stricta	65.1	152	5e-62
Carubv10018802m	Capsella rubella	69.2	130	9e-60
Carubv10018868m	Capsella rubella	74.2	120	3e-59

Showing 1 to 10 of 499 entries

Protein sequence

NEGQTNSNLIAPVTPCNVHQVFLNFRGVQLRYNFVSHLTKALARDGINFFIDEKEQRGEDLNNLFVRIEE
SSIALAIFSSRYPESKWCMDELVVMQKFAKQGSLRVIPIFYKVEPEDVRNPTRDSEFGKKFLSLAEASTQ
DQ