Eucgr.G01279.1.p (PRGDB228608)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228608	Eucgr.G01279.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.G01283.1.p	Eucalyptus grandis	63.9	108	1e-43
Eucgr.G00431.1.p	Eucalyptus grandis	58.7	92	1e-31
Eucgr.G01286.1.p	Eucalyptus grandis	57.6	92	1e-29
Eucgr.G00433.1.p	Eucalyptus grandis	56.5	92	6e-28
Eucgr.G01255.1.p	Eucalyptus grandis	48.4	93	6e-27
Eucgr.G01276.1.p	Eucalyptus grandis	52.2	92	3e-26
orange1.1g039731m	Citrus sinensis	43.7	103	1e-24
MDP0000449255	Malus domestica	40.8	103	1e-24
MDP0000864830	Malus domestica	39.8	103	2e-24
Eucgr.G01250.1.p	Eucalyptus grandis	46.8	94	6e-24

Showing 1 to 10 of 499 entries

Protein sequence

MLHTMSHLKSTLERREMKTFVDFTLDGGVPFRPAINEAVEWSKSAVVVVSQNYHLSPWCLNELVKILECQ
KRWGLVVLPIFWEMSARDLREQGGRFRGEYWPRRKGFQAG