mrna28512.1-v1.0-hybrid (PRGDB234633)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB234633	mrna28512.1-v1.0-hybrid	T	putative	TM, TIR	Fragaria vesca

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.8G120400.1.p	Prunus persica	71.6	169	1e-81
Prupe.8G119800.1.p	Prunus persica	65.9	170	3e-73
MDP0000309329	Malus domestica	59.9	172	1e-67
MDP0000190736	Malus domestica	59.3	172	1e-66
MDP0000222184	Malus domestica	61.7	154	2e-66
Prupe.8G118000.1.p	Prunus persica	59.8	169	3e-65
Prupe.2G088600.1.p	Prunus persica	63.4	153	9e-65
Prupe.2G068400.1.p	Prunus persica	61.8	152	3e-64
Prupe.8G108700.1.p	Prunus persica	59.3	150	7e-64
MDP0000194082	Malus domestica	58.5	152	9e-63

Showing 1 to 10 of 499 entries

Protein sequence

MKTSTRLRASSSSSTPLAHSWTYDVFICYRGADTRYHFADHLYSNLLQKGIKTFLADEVLNRGEELTLPM
IFQAIGESRISVILFSENFASSEWCLDELVEIMQCKQSTNQIVWPIYYKVDPSDVRNQHGSFGEALVNHE
SKFEDDMEKVMRWRTALNDAANLAAWIFGDG