MDP0000536292 (PRGDB258318)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258318	MDP0000536292	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000661138	Malus domestica	87.1	93	5e-51
MDP0000210081	Malus domestica	96.3	81	8e-50
MDP0000946278	Malus domestica	90.2	82	2e-47
MDP0000601632	Malus domestica	90.2	82	3e-47
MDP0000314565	Malus domestica	82.9	82	2e-40
MDP0000173893	Malus domestica	85.2	81	2e-38
MDP0000610616	Malus domestica	71.6	95	4e-38
MDP0000216668	Malus domestica	78	82	9e-35
MDP0000433167	Malus domestica	66.7	99	2e-34
Prupe.2G126500.1.p	Prunus persica	74.4	82	6e-34

Showing 1 to 10 of 499 entries

Protein sequence

MALVRTSPGTSSDSNTFRSYRYDVFLSFRGEETRKTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQ
KAIQQSRTSVITRHPGGVLMSLC