MDP0000210081 (PRGDB258312)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258312	MDP0000210081	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000661138	Malus domestica	97.8	90	3e-55
MDP0000601632	Malus domestica	92.2	90	2e-51
MDP0000946278	Malus domestica	92.2	90	2e-51
MDP0000536292	Malus domestica	96.3	81	7e-50
MDP0000173893	Malus domestica	87.6	89	2e-45
MDP0000314565	Malus domestica	84.4	90	3e-43
MDP0000610616	Malus domestica	72.8	103	1e-41
MDP0000216668	Malus domestica	80	90	6e-39
MDP0000150743	Malus domestica	75.6	90	9e-38
MDP0000605598	Malus domestica	81.5	81	2e-35

Showing 1 to 10 of 499 entries

Protein sequence

MALVRTSPGTSSDSNTFRSYRYDVFLSFRGETRKTFTDHLYTALNNAGFLTFRDDDELERGEDIKPGLQN
AIQQSRTSVVVFSKDYASSX