MDP0000433167 (PRGDB258334)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB258334	MDP0000433167	T	putative	TIR	Malus domestica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
MDP0000536292	Malus domestica	66.7	99	2e-34
MDP0000661138	Malus domestica	87.3	63	7e-31
MDP0000314565	Malus domestica	90.5	63	2e-30
MDP0000946278	Malus domestica	85.7	63	3e-30
MDP0000601632	Malus domestica	85.7	63	3e-30
MDP0000210081	Malus domestica	85.7	63	6e-30
MDP0000173893	Malus domestica	82.5	63	7e-26
MDP0000216668	Malus domestica	77.8	63	1e-24
MDP0000150743	Malus domestica	73	63	6e-23
Prupe.2G126100.1.p	Prunus persica	62.4	85	2e-22

Showing 1 to 10 of 499 entries

Protein sequence

MALVRAAQGTSSDSNTHWGYRYDVFLSFRGEDTRRTFTDHLYTALNNAGFLTXRDDDELERGEISSXDYR
KQSGNQKRLLSCFRKXXRHPDGALMSLS