Potri.011G012500.1 (PRGDB2113392)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113392	Potri.011G012500.1	T	putative	TIR	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.011G015400.2	Populus trichocarpa	98.6	71	2e-44
Potri.011G015400.1	Populus trichocarpa	98.6	71	5e-42
Potri.011G008500.1	Populus trichocarpa	88.6	70	1e-38
Potri.011G014500.1	Populus trichocarpa	90	70	1e-38
Potri.T038900.1	Populus trichocarpa	90.1	71	4e-38
Potri.011G008800.1	Populus trichocarpa	90.1	71	4e-38
Potri.T040100.1	Populus trichocarpa	85.9	71	3e-37
Potri.011G014100.2	Populus trichocarpa	83.1	71	3e-36
Potri.011G014100.1	Populus trichocarpa	83.1	71	3e-36
Potri.T037900.1	Populus trichocarpa	87.3	71	6e-36

Showing 1 to 10 of 499 entries

Protein sequence

MIMERRRTTGSIVFPVFYDVLPSEVRNQTGSFAAAFVEQEKRFKEEMERVNGWRIALKEVADLAGMVLGD
G