Potri.006G228500.5 (PRGDB2113489)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113489	Potri.006G228500.5	N	putative	NBS	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.006G228500.10	Populus trichocarpa	99.9	117	1e-83
Potri.012G109400.1	Populus trichocarpa	99.2	117	1e-82
SapurV1A.0086s0380.1.p	Salix purpurea	94.9	117	9e-69
AHYPO_022389-RA	Amaranthus hypochondriacus	85.3	109	6e-58
PGSC0003DMT400019371	Solanum tuberosum	73.5	117	1e-48
Solyc06g075310.2.1	Solanum lycopersicum	73.2	112	2e-46
Dusal.0627s00003.1.p	Dunaliella salina	65.5	110	6e-44
8345	Ostreococcus lucimarinus	41.4	116	4e-25
ConsensusfromContig15674-maker-ConsensusfromContig15674-snap-gene-0.1-mRNA-1:cds:4834/324-343:1:-	Cyanophora paradoxa	53.8	106	3e-20
AAM30321.1		28.9	121	6e-8

Showing 1 to 10 of 10 entries

Protein sequence

MAQGDSDMRKKPNILITGTPGTGKTTTASALAEATQFRHINIGDLVKEKNLHDGWDDQFDCYIINEDLVC
DELEDIMEEGGNIVDYHGCDFFPERWFDQVVVLQTDNSVLYDRLSKR