PGSC0003DMT400019371 (PRGDB2135338)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2135338	PGSC0003DMT400019371	N	putative	NBS, TM	Solanum tuberosum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Solyc06g075310.2.1	Solanum lycopersicum	90.6	117	4e-63
Potri.006G228500.5	Populus trichocarpa	73.5	117	2e-48
Potri.006G228500.10	Populus trichocarpa	73.5	117	2e-48
Potri.012G109400.1	Populus trichocarpa	73.5	117	3e-48
SapurV1A.0086s0380.1.p	Salix purpurea	72.7	117	2e-47
AHYPO_022389-RA	Amaranthus hypochondriacus	67	109	9e-42
Dusal.0627s00003.1.p	Dunaliella salina	60	115	1e-34
8345	Ostreococcus lucimarinus	38.4	125	4e-20
ConsensusfromContig15674-maker-ConsensusfromContig15674-snap-gene-0.1-mRNA-1:cds:4834/324-343:1:-	Cyanophora paradoxa	47.5	122	6e-18

Showing 1 to 9 of 9 entries

Protein sequence

MAQNSSCRKRPNILITGTPGTGKTTTAAALAEVMELRHINVGDFANEENLTNGWDDTFDSYYINEDLVCD
ALENLMEEGGNIVDHHACDFFPECCFDRVVVLQTDSSVLYDRFTKRYSYQLILTFRFVCISSIALLNV