Solyc06g075310.2.1 (PRGDB2133615)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2133615	Solyc06g075310.2.1	N	putative	NBS	Solanum lycopersicum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
PGSC0003DMT400019371	Solanum tuberosum	90.6	117	3e-64
Potri.006G228500.5	Populus trichocarpa	73.2	112	8e-47
Potri.006G228500.10	Populus trichocarpa	73.2	112	8e-47
Potri.012G109400.1	Populus trichocarpa	72.6	113	8e-47
SapurV1A.0086s0380.1.p	Salix purpurea	74.1	108	2e-45
AHYPO_022389-RA	Amaranthus hypochondriacus	64.8	108	3e-39
Dusal.0627s00003.1.p	Dunaliella salina	59.8	107	1e-33
ConsensusfromContig15674-maker-ConsensusfromContig15674-snap-gene-0.1-mRNA-1:cds:4834/324-343:1:-	Cyanophora paradoxa	47.8	113	2e-16
8345	Ostreococcus lucimarinus	36.8	114	3e-16

Showing 1 to 9 of 9 entries

Protein sequence

MTQNSSGRKRPNILITGTPGTGKTTTAAALAEVTALRHINVGDFANEENLTNGWDDTFDCYYINEDLVCD
ALEKLMEEGGNIVDHHACDFFPECCFDCVVVLQTDSSVLHERFTKSFVGRGKRELSRRYFGHT