ConsensusfromContig15674-maker-ConsensusfromContig15674-snap-gene-0.1-mRNA-1:cds:4834/324-343:1:- (PRGDB2176891)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2176891	ConsensusfromContig15674-maker-ConsensusfromContig15674-snap-gene-0.1-mRNA-1:cds:4834/324-343:1:-	N	putative	NBS	Cyanophora paradoxa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AHYPO_022389-RA	Amaranthus hypochondriacus	51.8	166	1e-42
Dusal.0627s00003.1.p	Dunaliella salina	52.8	163	2e-41
Potri.012G109400.1	Populus trichocarpa	50.9	167	2e-39
SapurV1A.0086s0380.1.p	Salix purpurea	49.1	169	3e-38
8345	Ostreococcus lucimarinus	37.9	169	2e-30
Potri.006G228500.5	Populus trichocarpa	53.8	106	5e-20
Potri.006G228500.10	Populus trichocarpa	53.8	106	5e-20
PGSC0003DMT400019371	Solanum tuberosum	47.5	122	2e-18
Solyc06g075310.2.1	Solanum lycopersicum	46.1	117	5e-16

Showing 1 to 9 of 9 entries

Protein sequence

MPARAPRRTKPNVLISGTPGTGKTTTAEQLASKILTHVNVGKLVVDELEELMGQGGVIVDHHGVDFFPER
WFDLVVVLRTDNEVLYPRLEGGYSQKKISENIECEIMQVILDEAKDSYKEDIIWELPSNTNDDLEANLEK
IEEWVNEWRPRWQRYS