Dusal.0627s00003.1.p (PRGDB228197)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228197	Dusal.0627s00003.1.p	CN	putative	NBS, CC	Dunaliella salina

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.012G109400.1	Populus trichocarpa	58.5	164	8e-63
SapurV1A.0086s0380.1.p	Salix purpurea	57.4	162	1e-59
AHYPO_022389-RA	Amaranthus hypochondriacus	55.3	161	3e-59
Potri.006G228500.5	Populus trichocarpa	65.5	110	2e-43
Potri.006G228500.10	Populus trichocarpa	65.5	110	2e-43
8345	Ostreococcus lucimarinus	45.5	167	3e-42
ConsensusfromContig15674-maker-ConsensusfromContig15674-snap-gene-0.1-mRNA-1:cds:4834/324-343:1:-	Cyanophora paradoxa	52.8	163	4e-41
PGSC0003DMT400019371	Solanum tuberosum	60	115	1e-34
Solyc06g075310.2.1	Solanum lycopersicum	59.8	107	4e-33
AAM30321.1		28.3	173	1e-13

Showing 1 to 10 of 10 entries

Protein sequence

MSQRPNVLICGTPGTGKTTTAEAVAQQAGYNHINVGQWVAERGLHSGWDEEFNCWTIDEDKVCDAMEDVM
AEGGNIVDHHGCEFFPERWFDLVLVLQADNTVLYDRLEKRGYNAQKIQENVECEIMMVILEEARENYKEE
IVRTLPSNTVEQLEANVAQIVTWIREQDRMR