Bostr.30057s0052.2.p (PRGDB212913)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB212913	Bostr.30057s0052.2.p	CT	putative	CC, TIR	Babiana stricta

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.30057s0052.1.p	Babiana stricta	99.9	143	1e-101
Araha.46223s0001.1.p	Arabidopsis halleri	78	123	2e-62
Carubv10018648m	Capsella rubella	65.5	116	7e-42
893751	Arabidopsis lyrata	62.2	119	1e-41
Araha.13567s0001.1.p	Arabidopsis halleri	68	103	5e-41
AT1G47370.1	Arabidopsis thaliana	69.5	105	1e-40
Araha.37770s0001.1.p	Arabidopsis halleri	69.3	101	1e-40
AT1G57850.2	Arabidopsis thaliana	89.2	74	3e-40
864783	Arabidopsis lyrata	67	103	3e-40
Carubv10019041m	Capsella rubella	66.7	102	5e-40

Showing 1 to 10 of 499 entries

Protein sequence

MDELVKIKKRVDKGKLQVIPIFYKVRARDVREQTGEFGDMFWALAITSRGDQIMQWKEALEYISNKMGLS
LGDKSSEADLIKEIVKELERLLAEIRRKDTEDYQCIINFLHNKRRKMYHFFPECEKKSLVNGHINLSNAR
GQD