Aco015996.1 (PRGDB24958)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB24958	Aco015996.1	N	putative	NBS, TM	Ananas comosus

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
KN539545.1_FGP007	Oryza longistaminata	70.6	187	2e-81
Pavir.Da02384.1.p	Panicum virgatum	69.3	176	1e-76
BGIOSGA022182-PA	Oryza sativa Indica Group	70	187	7e-75
ONIVA06G01320.1	Oryza nivara	71.3	178	1e-74
OBART06G00960.1	Oryza barthii	70.8	178	7e-74
874982	Arabidopsis lyrata	54	187	7e-70
Cagra.0839s0003.1.p	Conradina grandiflora	55.7	176	8e-69
Bo9g024250.1	Brassica oleracea	56.7	171	2e-68
AT2G16790.1	Arabidopsis thaliana	54.2	179	3e-67
Araha.1718s0003.1.p	Arabidopsis halleri	51.6	188	2e-65

Showing 1 to 10 of 21 entries

Protein sequence

MDAATSDLAGLGIVIMGVSGCGKSTVAELLAKALQCSFIEADDFHSPANKAKMSKGIPLTDADRTPWLEA
LRDAIKEKLLLGENVTVSCSALQKKYREILRSSDISYKPGSFSKCRVKFMCLEAPAELIAARMKKRSEEG
KHFMPASLLRSQLDLLQIDEAEGISKIDASMRSEKIVDDVLVLFKGTWRCAL