Bo9g024250.1 (PRGDB219918)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB219918	Bo9g024250.1	N	putative	NBS, TM	Brassica oleracea

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AT2G16790.2	Arabidopsis thaliana	89.2	186	6e-122
AT2G16790.1	Arabidopsis thaliana	88.3	188	5e-120
Araha.1718s0003.4.p	Arabidopsis halleri	89.2	186	4e-119
Araha.1718s0003.3.p	Arabidopsis halleri	89.2	186	4e-119
874982	Arabidopsis lyrata	87.7	187	8e-119
Araha.1718s0003.2.p	Arabidopsis halleri	88.3	188	2e-117
Araha.1718s0003.1.p	Arabidopsis halleri	88.3	188	2e-117
Cagra.0839s0003.1.p	Conradina grandiflora	88.3	179	2e-116
Aco015996.1	Ananas comosus	56.7	171	2e-68
Phvul.003G054200.1	Phaseolus vulgaris	52.5	179	1e-65

Showing 1 to 10 of 21 entries

Protein sequence

MSTNNDGKVIVIMGVSGAGKSTIGKMLGTALSCDFLDADDFHSSSNRDKMRQGIALSDEDRMPWLEKIQE
SLRERLLNGQTVVLACSSLRKQYREILRGSDPDYKPGSYSSCKVKFVLLEGNAEVIAARLQKRASEGEHF
MPLTLLRSQFDLLEADDCEKIFKVSVVLSPEVIVNSVLELVSNDLNS