Cagra.0839s0003.1.p (PRGDB225326)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB225326	Cagra.0839s0003.1.p	N	putative	NBS, TM	Conradina grandiflora

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AT2G16790.1	Arabidopsis thaliana	89.4	189	4e-122
874982	Arabidopsis lyrata	88.8	187	2e-120
AT2G16790.2	Arabidopsis thaliana	91.7	181	1e-119
Araha.1718s0003.2.p	Arabidopsis halleri	89.4	188	1e-119
Araha.1718s0003.1.p	Arabidopsis halleri	89.4	188	1e-119
Araha.1718s0003.4.p	Arabidopsis halleri	91.7	180	4e-117
Araha.1718s0003.3.p	Arabidopsis halleri	91.7	180	4e-117
Bo9g024250.1	Brassica oleracea	88.3	179	2e-116
Aco015996.1	Ananas comosus	55.7	176	8e-69
Phvul.003G054200.1	Phaseolus vulgaris	55.4	175	4e-66

Showing 1 to 10 of 21 entries

Protein sequence

MLGDNEVSGQVIVIMGVSGAGKSTIGKMLGTALSCDFLDADDFHSLSNRDKMSQGIALTDEDRMPWLEKI
QDSLRKRLLNRETVVLACSSLRKQYREILRGSDPDYKPGTYTSCKVKFVLLEGNAEVIAARLQKRASEGE
HFMPLTLLQSQFDLLQADECEKIFKISVVLSPEVIVNTILDMVTDSLYP