AT2G16790.1 (PRGDB211262)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB211262	AT2G16790.1	N	putative	NBS, TM	Arabidopsis thaliana

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AT2G16790.2	Arabidopsis thaliana	98.9	189	4e-134
874982	Arabidopsis lyrata	94.1	187	3e-127
Araha.1718s0003.2.p	Arabidopsis halleri	94.7	188	1e-126
Araha.1718s0003.1.p	Arabidopsis halleri	94.7	188	1e-126
Araha.1718s0003.4.p	Arabidopsis halleri	93.6	188	4e-123
Araha.1718s0003.3.p	Arabidopsis halleri	93.6	188	4e-123
Cagra.0839s0003.1.p	Conradina grandiflora	89.4	189	4e-122
Bo9g024250.1	Brassica oleracea	88.3	188	5e-120
Aco015996.1	Ananas comosus	54.2	179	3e-67
Phvul.003G054200.1	Phaseolus vulgaris	53	181	2e-63

Showing 1 to 10 of 21 entries

Protein sequence

MSAKNDVTGKVIAIMGVSGAGKSTIGKMLGKALSCDFLDADDFHSLSNRDKMRQGIALSDEDRMPWLEKI
QESLRKRLLDGETVVLACSSLRKQYREILRGSDPDYKPGSYTSCKVTFVLLEGNAEVIAARLQKRASEEE
HFMPLTLLQSQFDLLQADECEKIFKISVVLSPEVIVNTILEMVANSLNP