874982 (PRGDB29795)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29795	874982	N	putative	NBS, TM	Arabidopsis lyrata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.1718s0003.1.p	Arabidopsis halleri	94.3	192	1e-128
Araha.1718s0003.2.p	Arabidopsis halleri	94.3	192	1e-128
AT2G16790.1	Arabidopsis thaliana	94.1	187	3e-127
Araha.1718s0003.4.p	Arabidopsis halleri	93.8	192	9e-126
Araha.1718s0003.3.p	Arabidopsis halleri	93.8	192	9e-126
AT2G16790.2	Arabidopsis thaliana	93.6	187	2e-124
Cagra.0839s0003.1.p	Conradina grandiflora	88.8	187	2e-120
Bo9g024250.1	Brassica oleracea	87.7	187	8e-119
Aco015996.1	Ananas comosus	54	187	7e-70
Phvul.003G054200.1	Phaseolus vulgaris	54.1	181	3e-65

Showing 1 to 10 of 21 entries

Protein sequence

MSANNDVAGKVIVIMGVSGAGKSTIGKLLGKALSCDFLDADDFHSLSNRDKMRQGIALSDEDRMPWLEKI
QESLRKRLLDGETVVLACSSLRKQYREILRGSDPDYEQGSYTSCKVKFVLLEGNAEVIAARLQKRASEGE
HFMPLTLLQSQFDLLQADECEKIFKISVILSPEVIVNTILEMLGNSLREGI