Potri.011G015100.1 (PRGDB2113408)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113408	Potri.011G015100.1	T	putative	TIR	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Potri.T165200.1	Populus trichocarpa	93.5	62	1e-36
Potri.011G015400.2	Populus trichocarpa	88.7	62	1e-33
Potri.T038500.1	Populus trichocarpa	83.9	62	5e-32
Potri.T039900.1	Populus trichocarpa	90.3	62	6e-32
Potri.T039600.1	Populus trichocarpa	85.5	62	8e-32
Potri.T040100.1	Populus trichocarpa	85.5	62	1e-31
Potri.011G014100.2	Populus trichocarpa	85.5	62	1e-31
Potri.011G014100.1	Populus trichocarpa	85.5	62	1e-31
SapurV1A.0067s0310.1.p	Salix purpurea	85.5	62	2e-31
Potri.T039200.1	Populus trichocarpa	83.9	62	3e-31

Showing 1 to 10 of 499 entries

Protein sequence

MASGKYQESSFSRFSNCKYQVFLSFRGEDTRKNFTDDLYTTLVQAGIHTFRDDDEIRRGENI