Spipo0G0015900 (PRGDB2140832)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2140832	Spipo0G0015900	N	putative	NBS, TM	Spirodela polyrhiza

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
KN539545.1_FGP007	Oryza longistaminata	66.7	42	3e-14
Araha.1718s0003.2.p	Arabidopsis halleri	62.8	43	4e-12
Araha.1718s0003.1.p	Arabidopsis halleri	62.8	43	4e-12
874982	Arabidopsis lyrata	62.8	43	4e-12
Araha.1718s0003.4.p	Arabidopsis halleri	61.4	44	7e-12
Araha.1718s0003.3.p	Arabidopsis halleri	61.4	44	7e-12
Bo9g024250.1	Brassica oleracea	65	40	1e-11
AT2G16790.1	Arabidopsis thaliana	60.5	43	2e-11
BGIOSGA022182-PA	Oryza sativa Indica Group	65.8	41	3e-11
AT2G16790.2	Arabidopsis thaliana	62.5	40	7e-11

Showing 1 to 10 of 18 entries

Protein sequence

MASGGRENAAFEADPPGKIIVIMGVSGAGKTTIGQRLAEDLGCTFLEGDDFHPQANIEEGILERVSKRAG
PNTS