AT2G16790.2 (PRGDB211263)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB211263	AT2G16790.2	N	putative	NBS, TM	Arabidopsis thaliana

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AT2G16790.1	Arabidopsis thaliana	98.9	189	4e-134
Araha.1718s0003.4.p	Arabidopsis halleri	94.6	186	6e-125
Araha.1718s0003.3.p	Arabidopsis halleri	94.6	186	6e-125
874982	Arabidopsis lyrata	93.6	187	2e-124
Araha.1718s0003.2.p	Arabidopsis halleri	93.6	188	4e-123
Araha.1718s0003.1.p	Arabidopsis halleri	93.6	188	4e-123
Bo9g024250.1	Brassica oleracea	89.2	186	6e-122
Cagra.0839s0003.1.p	Conradina grandiflora	91.7	181	1e-119
Phvul.003G054200.1	Phaseolus vulgaris	53.6	179	2e-65
Aco015996.1	Ananas comosus	55.2	172	2e-65

Showing 1 to 10 of 21 entries

Protein sequence

MSAKNDGKVIAIMGVSGAGKSTIGKMLGKALSCDFLDADDFHSLSNRDKMRQGIALSDEDRMPWLEKIQE
SLRKRLLDGETVVLACSSLRKQYREILRGSDPDYKPGSYTSCKVTFVLLEGNAEVIAARLQKRASEEEHF
MPLTLLQSQFDLLQADECEKIFKISVVLSPEVIVNTILEMVANSLNP